SCOPe 2.03: Domain d3l71b2: 3l71 B:236-439

Lineage for d3l71b2 (3l71 B:236-439)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.0: automated matches [232765] (1 protein)
   not a true family

6. Protein automated matches [232766] (1 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [232768] (2 PDB entries)

8. Domain d3l71b2: 3l71 B:236-439 [232797]
   Other proteins in same PDB: d3l71c1, d3l71c2, d3l71d1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71p1, d3l71p2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
   automated match to d1ppjb2
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71b2

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (B:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l71b2:

Sequence; same for both SEQRES and ATOM records:

>d3l71b2 d.185.1.0 (B:236-439) automated matches {Gallus gallus [TaxId: 9031]}
katywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtskl
yqgvakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvtee
dvtkaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaak
kfvsgkksmaasgdlgstpfldel

Timeline for d3l71b2:

• d3l71b2 is new in SCOPe 2.03-stable
  
• d3l71b2 appears in SCOPe 2.04
  
• d3l71b2 appears in the current release, SCOPe 2.08