Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
Protein automated matches [232766] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
Domain d3l71o1: 3l71 O:18-235 [232776] Other proteins in same PDB: d3l71c1, d3l71c2, d3l71d1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ automated match to d1be3b1 complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71o1 d.185.1.0 (O:18-235) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} cpgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlaspltt kgassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwev tdlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqn nftsarmalvgigvkhsdlkqvaeqflnirsgagtssa
Timeline for d3l71o1: