Lineage for d3l71o1 (3l71 O:18-235)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1444881Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1444882Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1445145Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 1445146Protein automated matches [232766] (1 species)
    not a true protein
  7. Species Gallus gallus [TaxId:9031] [232768] (2 PDB entries)
  8. 1445154Domain d3l71o1: 3l71 O:18-235 [232776]
    Other proteins in same PDB: d3l71c1, d3l71c2, d3l71d1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71p1, d3l71p2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
    automated match to d1be3b1

Details for d3l71o1

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (O:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l71o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71o1 d.185.1.0 (O:18-235) automated matches {Gallus gallus [TaxId: 9031]}
cpgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlaspltt
kgassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwev
tdlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqn
nftsarmalvgigvkhsdlkqvaeqflnirsgagtssa

SCOPe Domain Coordinates for d3l71o1:

Click to download the PDB-style file with coordinates for d3l71o1.
(The format of our PDB-style files is described here.)

Timeline for d3l71o1: