Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
Protein automated matches [232766] (1 species) not a true protein |
Domain d3l71a1: 3l71 A:1-233 [232772] Other proteins in same PDB: d3l71c1, d3l71c2, d3l71d1, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71p1, d3l71p2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ automated match to d1pp9a1 complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71a1 d.185.1.0 (A:1-233) automated matches {Gallus gallus [TaxId: 9031]} aatyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfve hlafkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqnc aleesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltra dlasyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr
Timeline for d3l71a1: