Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
Protein automated matches [232766] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
Domain d3l70o1: 3l70 O:18-235 [232770] Other proteins in same PDB: d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_ automated match to d1be3b1 complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70o1 d.185.1.0 (O:18-235) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} cpgaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlaspltt kgassfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwev tdlqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqn nftsarmalvgigvkhsdlkqvaeqflnirsgagtssa
Timeline for d3l70o1: