![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
![]() | Protein automated matches [226884] (6 species) not a true protein |
![]() | Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries) |
![]() | Domain d3l2ed1: 3l2e D:2-113 [232757] Other proteins in same PDB: d3l2ea2, d3l2ec2, d3l2ed2 automated match to d3l2fb1 |
PDB Entry: 3l2e (more details), 2.6 Å
SCOPe Domain Sequences for d3l2ed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2ed1 a.83.1.0 (D:2-113) automated matches {Namalycastis sp. [TaxId: 243920]} gsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpng vtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkp
Timeline for d3l2ed1: