Lineage for d3kd6b_ (3kd6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904662Species Chlorobaculum tepidum [TaxId:1097] [232683] (1 PDB entry)
  8. 2904664Domain d3kd6b_: 3kd6 B: [232685]
    Other proteins in same PDB: d3kd6a2
    automated match to d3b1rb_
    complexed with amp, gol

Details for d3kd6b_

PDB Entry: 3kd6 (more details), 1.88 Å

PDB Description: crystal structure of nucleoside kinase from chlorobium tepidum in complex with amp
PDB Compounds: (B:) Carbohydrate kinase, PfkB family

SCOPe Domain Sequences for d3kd6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kd6b_ c.72.1.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
sllvigslafddietpfgrsdntlggsstyialsasyftdepirmvgvvgsdfgkehfdl
lhaknidtrgiqviedgktfrwagryhydmntrdtldtqlnvfaefdphvpqyyrdskfv
clgnidpelqlkvldqiddpklvvcdtmnfwiegkpeelkkvlarvdvfivndsearlls
gdpnlvktariiremgpktliikkgehgallftdngifaapafplesiydptgagdtfag
gfighlarcgntseaemrkavlygsamasfcveqfgpyryndldllevddryqsflel

SCOPe Domain Coordinates for d3kd6b_:

Click to download the PDB-style file with coordinates for d3kd6b_.
(The format of our PDB-style files is described here.)

Timeline for d3kd6b_: