Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (25 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [232666] (1 PDB entry) |
Domain d3k3pb2: 3k3p B:127-346 [232669] Other proteins in same PDB: d3k3pa1, d3k3pb1 automated match to d3n8da2 |
PDB Entry: 3k3p (more details), 2.23 Å
SCOPe Domain Sequences for d3k3pb2:
Sequence, based on SEQRES records: (download)
>d3k3pb2 d.142.1.0 (B:127-346) automated matches {Streptococcus mutans [TaxId: 1309]} dkittnqvlesattipqvayvaliegeplesklaeveekliypvfvkpanmgssvgiska enrtdlkqaialalkydsrvlieqgvdareievgilgntdvkttlpgeivkdvafydyea kyidnkitmaipaeidpvivekmrdyaatafrtlgccglsrcdffltedgkvylnelntm pgftqwsmypllwenmglsysvlieelvslakemfdkres
>d3k3pb2 d.142.1.0 (B:127-346) automated matches {Streptococcus mutans [TaxId: 1309]} dkittnqvlesattipqvayvaliegeplesklaeveekliypvfvkpangiskaenrtd lkqaialalkydsrvlieqgvdareievgilgntdvkttlpgeivtmaipaeidpvivek mrdyaatafrtlgccglsrcdffltedgkvylnelntmpgftsmypllwenmglsysvli eelvslakemfdkres
Timeline for d3k3pb2: