Lineage for d3k3pb2 (3k3p B:127-346)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433300Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1433301Protein automated matches [226904] (18 species)
    not a true protein
  7. 1433352Species Streptococcus mutans [TaxId:1309] [232666] (1 PDB entry)
  8. 1433354Domain d3k3pb2: 3k3p B:127-346 [232669]
    Other proteins in same PDB: d3k3pa1, d3k3pb1
    automated match to d3n8da2

Details for d3k3pb2

PDB Entry: 3k3p (more details), 2.23 Å

PDB Description: crystal structure of the apo form of d-alanine:d-alanine ligase (ddl) from streptococcus mutans
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3k3pb2:

Sequence, based on SEQRES records: (download)

>d3k3pb2 d.142.1.0 (B:127-346) automated matches {Streptococcus mutans [TaxId: 1309]}
dkittnqvlesattipqvayvaliegeplesklaeveekliypvfvkpanmgssvgiska
enrtdlkqaialalkydsrvlieqgvdareievgilgntdvkttlpgeivkdvafydyea
kyidnkitmaipaeidpvivekmrdyaatafrtlgccglsrcdffltedgkvylnelntm
pgftqwsmypllwenmglsysvlieelvslakemfdkres

Sequence, based on observed residues (ATOM records): (download)

>d3k3pb2 d.142.1.0 (B:127-346) automated matches {Streptococcus mutans [TaxId: 1309]}
dkittnqvlesattipqvayvaliegeplesklaeveekliypvfvkpangiskaenrtd
lkqaialalkydsrvlieqgvdareievgilgntdvkttlpgeivtmaipaeidpvivek
mrdyaatafrtlgccglsrcdffltedgkvylnelntmpgftsmypllwenmglsysvli
eelvslakemfdkres

SCOPe Domain Coordinates for d3k3pb2:

Click to download the PDB-style file with coordinates for d3k3pb2.
(The format of our PDB-style files is described here.)

Timeline for d3k3pb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k3pb1