Lineage for d3k3pb1 (3k3p B:3-126)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120847Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2120848Protein automated matches [226903] (35 species)
    not a true protein
  7. 2120971Species Streptococcus mutans [TaxId:1309] [232664] (1 PDB entry)
  8. 2120973Domain d3k3pb1: 3k3p B:3-126 [232668]
    Other proteins in same PDB: d3k3pa2, d3k3pb2
    automated match to d3n8da1

Details for d3k3pb1

PDB Entry: 3k3p (more details), 2.23 Å

PDB Description: crystal structure of the apo form of d-alanine:d-alanine ligase (ddl) from streptococcus mutans
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3k3pb1:

Sequence, based on SEQRES records: (download)

>d3k3pb1 c.30.1.0 (B:3-126) automated matches {Streptococcus mutans [TaxId: 1309]}
ketlvllyggrsaerdvsvlsaesvmrainydnflvktyfitqagdfiktqefdsqpset
dklmtndtiiasqkikpsdiyeeeavvfpvlhgpmgedgsiqgflevlkmpyvgtnilss
svam

Sequence, based on observed residues (ATOM records): (download)

>d3k3pb1 c.30.1.0 (B:3-126) automated matches {Streptococcus mutans [TaxId: 1309]}
ketlvllyggrsaerdvsvlsaesvmrainydnflvktyfitqagdfiktqefdsqpsdk
lmtndtiiasqkikpsdiyeeeavvfpvlhgpmgedgsiqgflevlkmpyvgtnilsssv
am

SCOPe Domain Coordinates for d3k3pb1:

Click to download the PDB-style file with coordinates for d3k3pb1.
(The format of our PDB-style files is described here.)

Timeline for d3k3pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k3pb2