Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [232664] (1 PDB entry) |
Domain d3k3pb1: 3k3p B:3-126 [232668] Other proteins in same PDB: d3k3pa2, d3k3pb2 automated match to d3n8da1 |
PDB Entry: 3k3p (more details), 2.23 Å
SCOPe Domain Sequences for d3k3pb1:
Sequence, based on SEQRES records: (download)
>d3k3pb1 c.30.1.0 (B:3-126) automated matches {Streptococcus mutans [TaxId: 1309]} ketlvllyggrsaerdvsvlsaesvmrainydnflvktyfitqagdfiktqefdsqpset dklmtndtiiasqkikpsdiyeeeavvfpvlhgpmgedgsiqgflevlkmpyvgtnilss svam
>d3k3pb1 c.30.1.0 (B:3-126) automated matches {Streptococcus mutans [TaxId: 1309]} ketlvllyggrsaerdvsvlsaesvmrainydnflvktyfitqagdfiktqefdsqpsdk lmtndtiiasqkikpsdiyeeeavvfpvlhgpmgedgsiqgflevlkmpyvgtnilsssv am
Timeline for d3k3pb1: