SCOPe 2.05: Domain d3k2mc_: 3k2m C:

Lineage for d3k2mc_ (3k2m C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)

8. Domain d3k2mc_: 3k2m C: [232662]
   Other proteins in same PDB: d3k2ma_, d3k2mb_
   automated match to d2ck2a_
   complexed with po4

Details for d3k2mc_

PDB Entry: 3k2m, 1.75 Å

PDB Description: crystal structure of monobody ha4/abl1 sh2 domain complex

PDB Compounds: (C:) Monobody HA4

SCOPe Domain Sequences for d3k2mc_:

Sequence; same for both SEQRES and ATOM records:

>d3k2mc_ b.1.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssvssvptklevvaatptslliswdapmssssvyyyritygetggnspvqeftvpysss
tatisglspgvdytitvyawgedsagymfmyspisinyrtc

Timeline for d3k2mc_:

• d3k2mc_ first appeared in SCOPe 2.03
  
• d3k2mc_ appears in SCOPe 2.04
  
• d3k2mc_ appears in SCOPe 2.06
  
• d3k2mc_ appears in the current release, SCOPe 2.08