Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein automated matches [190569] (7 species) not a true protein |
Species Escherichia coli [TaxId:488477] [232652] (1 PDB entry) |
Domain d3jwnn1: 3jwn N:1-158 [232655] Other proteins in same PDB: d3jwnc1, d3jwnc2, d3jwni1, d3jwni2 automated match to d4av5a_ complexed with gol |
PDB Entry: 3jwn (more details), 2.69 Å
SCOPe Domain Sequences for d3jwnn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwnn1 b.2.3.2 (N:1-158) automated matches {Escherichia coli [TaxId: 488477]} facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d3jwnn1: