Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
Domain d3jwdc2: 3jwd C:1098-1183 [232650] Other proteins in same PDB: d3jwdc1, d3jwdc3, d3jwdd1, d3jwdl1, d3jwdl2, d3jwdo1, d3jwdo2 automated match to d2nxyb2 complexed with gol, nag |
PDB Entry: 3jwd (more details), 2.61 Å
SCOPe Domain Sequences for d3jwdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwdc2 b.1.1.3 (C:1098-1183) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqkas
Timeline for d3jwdc2: