Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries) |
Domain d3jwdc1: 3jwd C:1000-1097 [232648] Other proteins in same PDB: d3jwdc2, d3jwdd2, d3jwdl1, d3jwdl2, d3jwdo1, d3jwdo2 automated match to d2nxyb1 complexed with gol, nag |
PDB Entry: 3jwd (more details), 2.61 Å
SCOPe Domain Sequences for d3jwdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwdc1 b.1.1.1 (C:1000-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} mkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr slwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d3jwdc1: