Lineage for d3jwdc1 (3jwd C:1000-1097)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755540Protein CD4 V-set domains [48737] (2 species)
  7. 1755541Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries)
  8. 1755554Domain d3jwdc1: 3jwd C:1000-1097 [232648]
    Other proteins in same PDB: d3jwdc2, d3jwdd2, d3jwdl1, d3jwdl2, d3jwdo1, d3jwdo2
    automated match to d2nxyb1
    complexed with gol, nag

Details for d3jwdc1

PDB Entry: 3jwd (more details), 2.61 Å

PDB Description: structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d3jwdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jwdc1 b.1.1.1 (C:1000-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
mkkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrr
slwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d3jwdc1:

Click to download the PDB-style file with coordinates for d3jwdc1.
(The format of our PDB-style files is described here.)

Timeline for d3jwdc1: