Lineage for d3iv2a_ (3iv2 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1888974Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1888975Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1889773Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1889774Protein automated matches [190230] (17 species)
    not a true protein
  7. 1889788Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)
  8. 1889808Domain d3iv2a_: 3iv2 A: [232636]
    automated match to d2xu4a_
    complexed with gol, na, nag, so4; mutant

Details for d3iv2a_

PDB Entry: 3iv2 (more details), 2.2 Å

PDB Description: Crystal structure of mature apo-Cathepsin L C25A mutant
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d3iv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iv2a_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgpqg
negcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqeka
lmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnnk
ywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d3iv2a_:

Click to download the PDB-style file with coordinates for d3iv2a_.
(The format of our PDB-style files is described here.)

Timeline for d3iv2a_: