SCOPe 2.06: Domain d3it9b1: 3it9 B:8-258

Lineage for d3it9b1 (3it9 B:8-258)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225496] (14 PDB entries)

8. Domain d3it9b1: 3it9 B:8-258 [232622]
   Other proteins in same PDB: d3it9a2, d3it9b2, d3it9c2, d3it9d2
   automated match to d1nj4a2
   complexed with so4, suc

Details for d3it9b1

PDB Entry: 3it9, 2.1 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in apo state

PDB Compounds: (B:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3it9b1:

Sequence; same for both SEQRES and ATOM records:

>d3it9b1 e.3.1.0 (B:8-258) automated matches {Escherichia coli [TaxId: 562]}
apsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikltdmvtv
gkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvagsqesfig
lmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihkekeftfn
kirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktdrirfne
seklltwgfrf

Timeline for d3it9b1:

• d3it9b1 first appeared in SCOPe 2.03
  
• d3it9b1 appears in SCOPe 2.05
  
• d3it9b1 appears in SCOPe 2.07
  
• d3it9b1 appears in the current release, SCOPe 2.08