Lineage for d3it9a2 (3it9 A:259-352)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333960Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 1333961Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) (S)
  5. 1333989Family b.105.1.0: automated matches [231757] (1 protein)
    not a true family
  6. 1333990Protein automated matches [231758] (2 species)
    not a true protein
  7. 1333991Species Escherichia coli [TaxId:562] [232620] (1 PDB entry)
  8. 1333992Domain d3it9a2: 3it9 A:259-352 [232621]
    Other proteins in same PDB: d3it9a1, d3it9b1, d3it9c1
    automated match to d1hd8a1
    complexed with so4, suc

Details for d3it9a2

PDB Entry: 3it9 (more details), 2.1 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in apo state
PDB Compounds: (A:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3it9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3it9a2 b.105.1.0 (A:259-352) automated matches {Escherichia coli [TaxId: 562]}
fetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknlkasytltepqltap
lkkgqvvgtidfqlngksieqrplivmenveegg

SCOPe Domain Coordinates for d3it9a2:

Click to download the PDB-style file with coordinates for d3it9a2.
(The format of our PDB-style files is described here.)

Timeline for d3it9a2: