Class b: All beta proteins [48724] (174 folds) |
Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily) sandwich; 6 strands in 2 sheets |
Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families) |
Family b.105.1.0: automated matches [231757] (1 protein) not a true family |
Protein automated matches [231758] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [232620] (1 PDB entry) |
Domain d3it9a2: 3it9 A:259-352 [232621] Other proteins in same PDB: d3it9a1, d3it9b1, d3it9c1 automated match to d1hd8a1 complexed with so4, suc |
PDB Entry: 3it9 (more details), 2.1 Å
SCOPe Domain Sequences for d3it9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3it9a2 b.105.1.0 (A:259-352) automated matches {Escherichia coli [TaxId: 562]} fetvtpikpdatfvtqrvwfgdksevnlgageagsvtiprgqlknlkasytltepqltap lkkgqvvgtidfqlngksieqrplivmenveegg
Timeline for d3it9a2:
View in 3D Domains from other chains: (mouse over for more information) d3it9b1, d3it9b2, d3it9c1, d3it9c2 |