Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189507] (13 PDB entries) |
Domain d3ibda_: 3ibd A: [232582] automated match to d3g5nc_ complexed with cm5, cpz, hem, scn |
PDB Entry: 3ibd (more details), 2 Å
SCOPe Domain Sequences for d3ibda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ibda_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf lffttilqnfsmaspvapedidltpqecgvgkipptyqirflprh
Timeline for d3ibda_: