SCOPe 2.06: Domain d3i6tc2: 3i6t C:131-369

Lineage for d3i6tc2 (3i6t C:131-369)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (74 species)
   not a true protein

7. Species Jannaschia sp. [TaxId:290400] [232556] (1 PDB entry)

8. Domain d3i6tc2: 3i6t C:131-369 [232561]
   Other proteins in same PDB: d3i6ta1, d3i6tb1, d3i6tc1, d3i6td1
   automated match to d2p8ba2
   complexed with k, mg

Details for d3i6tc2

PDB Entry: 3i6t, 1.9 Å

PDB Description: crystal structure of muconate cycloisomerase from jannaschia sp.

PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d3i6tc2:

Sequence; same for both SEQRES and ATOM records:

>d3i6tc2 c.1.11.0 (C:131-369) automated matches {Jannaschia sp. [TaxId: 290400]}
rcrdriplscsiadpdfdkdlalmqrlqdddvriiklktgfkdhafdmmrlerlradfpa
fdirvdynqglhhdvalarvrdvatfkptfieqpvkahlrglmarirdavdvplladesi
fgpedmaehpeiadgvsikimksggltraqtvarmaaarglsayggdmfeaglahlagah
miaatpeitlgcefyqatyflcddilaapfpvadghvlvpdtpglgvdvdedalarfav

Timeline for d3i6tc2:

• d3i6tc2 first appeared in SCOPe 2.03
  
• d3i6tc2 appears in SCOPe 2.05
  
• d3i6tc2 appears in SCOPe 2.07
  
• d3i6tc2 appears in the current release, SCOPe 2.08