Lineage for d3i6ba_ (3i6b A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920424Species Escherichia coli [TaxId:37762] [232551] (1 PDB entry)
  8. 2920425Domain d3i6ba_: 3i6b A: [232552]
    automated match to d2r8xh_
    complexed with kdo, mg, po4

Details for d3i6ba_

PDB Entry: 3i6b (more details), 2.49 Å

PDB Description: crystal structure of yrbi lacking the last 8 residues, in complex with kdo and inorganic phosphate
PDB Compounds: (A:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3i6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6ba_ c.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 37762]}
slatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircal
tsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgdd
lidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgk

SCOPe Domain Coordinates for d3i6ba_:

Click to download the PDB-style file with coordinates for d3i6ba_.
(The format of our PDB-style files is described here.)

Timeline for d3i6ba_: