Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries) |
Domain d3i54b2: 3i54 B:145-223 [232549] Other proteins in same PDB: d3i54a1, d3i54a2, d3i54b1, d3i54b3, d3i54c1, d3i54d1, d3i54d3 automated match to d3r6sd2 protein/DNA complex; complexed with cmp |
PDB Entry: 3i54 (more details), 2.2 Å
SCOPe Domain Sequences for d3i54b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i54b2 a.4.5.0 (B:145-223) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi rlegksvlisdserlarra
Timeline for d3i54b2: