SCOPe 2.04: Domain d3i2fa1: 3i2f A:2-351

Lineage for d3i2fa1 (3i2f A:2-351)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)

6. Protein automated matches [232528] (2 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:104109] [232529] (9 PDB entries)

8. Domain d3i2fa1: 3i2f A:2-351 [232530]
   Other proteins in same PDB: d3i2fa2
   automated match to d1ju3a2
   complexed with cl, dbc, gol, so4; mutant

Details for d3i2fa1

PDB Entry: 3i2f, 2.5 Å

PDB Description: cocaine esterase with mutations t172r / g173q, bound to dtt adduct

PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3i2fa1:

Sequence; same for both SEQRES and ATOM records:

>d3i2fa1 c.69.1.21 (A:2-351) automated matches {Rhodococcus sp. [TaxId: 104109]}
vdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwle
fvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgv
tqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligrqlitsrsda
rpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislf
erlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgi
aatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw

Timeline for d3i2fa1:

• d3i2fa1 first appeared in SCOPe 2.03
  
• d3i2fa1 appears in SCOPe 2.05
  
• d3i2fa1 appears in the current release, SCOPe 2.08