SCOPe 2.06: Domain d3hv2a_: 3hv2 A:

Lineage for d3hv2a_ (3hv2 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [232518] (1 PDB entry)

8. Domain d3hv2a_: 3hv2 A: [232519]
   automated match to d2rjna_
   complexed with so4

Details for d3hv2a_

PDB Entry: 3hv2, 1.5 Å

PDB Description: crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5

PDB Compounds: (A:) Response regulator/HD domain protein

SCOPe Domain Sequences for d3hv2a_:

Sequence; same for both SEQRES and ATOM records:

>d3hv2a_ c.23.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
lnvatvtrrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevdlvisa
ahlpqmdgptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwddqelll
alrqalehqhsererl

Timeline for d3hv2a_:

• d3hv2a_ first appeared in SCOPe 2.03
  
• d3hv2a_ appears in SCOPe 2.05
  
• d3hv2a_ appears in SCOPe 2.07
  
• d3hv2a_ appears in the current release, SCOPe 2.08