SCOPe 2.06: Domain d3huma2: 3hum A:316-382

Lineage for d3huma2 (3hum A:316-382)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.2: Pencillin binding protein 4 (PbpD), C-terminal domain [110098] (1 protein)
   rudiment form of the PBP-5-like domain
   automatically mapped to Pfam PF09211

6. Protein Pencillin binding protein 4 (PbpD), C-terminal domain [110099] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110100] (3 PDB entries)
   Uniprot Q53613 21-383

8. Domain d3huma2: 3hum A:316-382 [232513]
   Other proteins in same PDB: d3huma1, d3humb1
   automated match to d1tvfa1
   complexed with cew

Details for d3huma2

PDB Entry: 3hum, 2.3 Å

PDB Description: crystal structure of penicillin binding protein 4 from staphylococcus aureus col in complex with cefotaxime

PDB Compounds: (A:) Penicillin-binding protein 4

SCOPe Domain Sequences for d3huma2:

Sequence; same for both SEQRES and ATOM records:

>d3huma2 b.105.1.2 (A:316-382) Pencillin binding protein 4 (PbpD), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
kyvkilskgeqringkkyyvendlydvlpsdfskkdyklvvedgkvhadyprefinkdyg
pptvevh

Timeline for d3huma2:

• d3huma2 first appeared in SCOPe 2.03
  
• d3huma2 appears in SCOPe 2.05
  
• d3huma2 appears in SCOPe 2.07
  
• d3huma2 appears in the current release, SCOPe 2.08