Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [232498] (1 PDB entry) |
Domain d3hp0e_: 3hp0 E: [232502] automated match to d3mybb_ |
PDB Entry: 3hp0 (more details), 2.32 Å
SCOPe Domain Sequences for d3hp0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hp0e_ c.14.1.0 (E:) automated matches {Bacillus subtilis [TaxId: 1423]} tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg iiryvetgqfp
Timeline for d3hp0e_: