SCOPe 2.06: Domain d3hp0b_: 3hp0 B:

Lineage for d3hp0b_ (3hp0 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [232498] (1 PDB entry)

8. Domain d3hp0b_: 3hp0 B: [232500]
   automated match to d3mybb_

Details for d3hp0b_

PDB Entry: 3hp0, 2.32 Å

PDB Description: crystal structure of a putative polyketide biosynthesis enoyl-coa hydratase (pksh) from bacillus subtilis

PDB Compounds: (B:) Putative polyketide biosynthesis enoyl-CoA hydratase homolog pksH

SCOPe Domain Sequences for d3hp0b_:

Sequence; same for both SEQRES and ATOM records:

>d3hp0b_ c.14.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tyqtikvrfqasvcyitfhrpeanntindtlieeclqvlnqcetstvtvvvleglpevfc
fgadfqeiyqemkrgrkqassqeplydlwmklqtgpyvtishvrgkvnagglgfvsatdi
aiadqtasfslsellfglypacvlpflirrigrqkahymtlmtkpisvqeasewglidaf
daesdvllrkhllrlrrlnkkgiahykqfmssldhqvsrakataltanqdmfsdpqnqmg
iiryvetgqfp

Timeline for d3hp0b_:

• d3hp0b_ first appeared in SCOPe 2.03
  
• d3hp0b_ appears in SCOPe 2.05
  
• d3hp0b_ appears in SCOPe 2.07
  
• d3hp0b_ appears in the current release, SCOPe 2.08