Lineage for d3hmya2 (3hmy A:1111-1315)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792430Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2792493Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2792542Protein automated matches [229100] (6 species)
    not a true protein
  7. 2792572Species Clostridium tetani [TaxId:1513] [232493] (3 PDB entries)
  8. 2792573Domain d3hmya2: 3hmy A:1111-1315 [232494]
    Other proteins in same PDB: d3hmya1
    automated match to d1a8da2
    complexed with gol, so4

Details for d3hmya2

PDB Entry: 3hmy (more details), 2 Å

PDB Description: crystal structure of hcr/t complexed with gt2
PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d3hmya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmya2 b.42.4.2 (A:1111-1315) automated matches {Clostridium tetani [TaxId: 1513]}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOPe Domain Coordinates for d3hmya2:

Click to download the PDB-style file with coordinates for d3hmya2.
(The format of our PDB-style files is described here.)

Timeline for d3hmya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hmya1