Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
Protein automated matches [229097] (6 species) not a true protein |
Species Clostridium tetani [TaxId:1513] [232491] (3 PDB entries) |
Domain d3hmya1: 3hmy A:866-1110 [232492] Other proteins in same PDB: d3hmya2 automated match to d1a8da1 complexed with gol, so4 |
PDB Entry: 3hmy (more details), 2 Å
SCOPe Domain Sequences for d3hmya1:
Sequence, based on SEQRES records: (download)
>d3hmya1 b.29.1.6 (A:866-1110) automated matches {Clostridium tetani [TaxId: 1513]} nldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihl vnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhsl sigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssan lyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekly tsyls
>d3hmya1 b.29.1.6 (A:866-1110) automated matches {Clostridium tetani [TaxId: 1513]} nldcwedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnne ssevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmksigsgwsv slkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlm gsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls
Timeline for d3hmya1: