Lineage for d3hmua_ (3hmu A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381313Species Silicibacter pomeroyi [TaxId:89184] [232488] (1 PDB entry)
  8. 1381314Domain d3hmua_: 3hmu A: [232489]
    automated match to d3gjua_
    complexed with cl, so4

Details for d3hmua_

PDB Entry: 3hmu (more details), 2.1 Å

PDB Description: crystal structure of a class iii aminotransferase from silicibacter pomeroyi
PDB Compounds: (A:) Aminotransferase, class III

SCOPe Domain Sequences for d3hmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmua_ c.67.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}
itnhmptaelqaldaahhlhpfsannalgeegtrvitrargvwlndsegeeildamaglw
cvnigygrdelaevaarqmrelpyyntffktthvpaialaqklaelapgdlnhvffaggg
seandtnirmvrtywqnkgqpektviisrknayhgstvassalggmagmhaqsglipdvh
hinqpnwwaeggdmdpeefglarareleeailelgenrvaafiaepvqgaggvivapdsy
wpeiqricdkydilliadevicgfgrtgnwfgtqtmgirphimtiakglssgyapiggsi
vcdevahvigkdefnhgytysghpvaaavalenlrileeenildhvrnvaapylkekwea
ltdhplvgeakivgmmasialtpnkasrakfasepgtigyicrercfannlimrhvgdrm
iispplvitpaeidemfvrirksldeaqaeiekqglmkseghhh

SCOPe Domain Coordinates for d3hmua_:

Click to download the PDB-style file with coordinates for d3hmua_.
(The format of our PDB-style files is described here.)

Timeline for d3hmua_: