SCOPe 2.03: Domain d3hi1l1: 3hi1 L:1-107

Lineage for d3hi1l1 (3hi1 L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)

8. Domain d3hi1l1: 3hi1 L:1-107 [232474]
   Other proteins in same PDB: d3hi1a2, d3hi1g_, d3hi1j_, d3hi1l2
   automated match to d1n0xl1
   complexed with nag

Details for d3hi1l1

PDB Entry: 3hi1, 2.9 Å

PDB Description: structure of hiv-1 gp120 (core with v3) in complex with cd4-binding- site antibody f105

PDB Compounds: (L:) f105 light chain

SCOPe Domain Sequences for d3hi1l1:

Sequence; same for both SEQRES and ATOM records:

>d3hi1l1 b.1.1.0 (L:1-107) automated matches {Homo sapiens [TaxId: 9606]}
eivltqspgtlslsageratlscrasqsvssrylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrvepedfavyycqqydnsvctfgqgtkleik

Timeline for d3hi1l1:

• d3hi1l1 is new in SCOPe 2.03-stable
  
• d3hi1l1 appears in SCOPe 2.04
  
• d3hi1l1 appears in the current release, SCOPe 2.08