SCOPe 2.03: Domain d3hg3b2: 3hg3 B:324-425

Lineage for d3hg3b2 (3hg3 B:324-425)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (11 PDB entries)
   alpha-galactosidase A

8. Domain d3hg3b2: 3hg3 B:324-425 [232471]
   Other proteins in same PDB: d3hg3a1, d3hg3b1
   automated match to d1r46a1
   complexed with 2pe, nag

Details for d3hg3b2

PDB Entry: 3hg3, 1.9 Å

PDB Description: human alpha-galactosidase catalytic mechanism 2. substrate bound

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d3hg3b2:

Sequence; same for both SEQRES and ATOM records:

>d3hg3b2 b.71.1.1 (B:324-425) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmqmsl

Timeline for d3hg3b2:

• d3hg3b2 is new in SCOPe 2.03-stable
  
• d3hg3b2 appears in SCOPe 2.04
  
• d3hg3b2 appears in the current release, SCOPe 2.08