SCOPe 2.08: Domain d3hcza1: 3hcz A:330-474

Lineage for d3hcza1 (3hcz A:330-474)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [232457] (1 PDB entry)

8. Domain d3hcza1: 3hcz A:330-474 [232458]
   Other proteins in same PDB: d3hcza2
   automated match to d4nmua_
   complexed with fmt, so4

Details for d3hcza1

PDB Entry: 3hcz, 1.88 Å

PDB Description: The crystal structure of a domain of possible thiol-disulfide isomerase from Cytophaga hutchinsonii ATCC 33406.

PDB Compounds: (A:) Possible thiol-disulfide isomerase

SCOPe Domain Sequences for d3hcza1:

Sequence; same for both SEQRES and ATOM records:

>d3hcza1 c.47.1.0 (A:330-474) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
plllgkkapnlymtdttgtyrylydvqakytilffwdsqcghcqqetpklydwwlknrak
giqvyaanierkdeewlkfirskkiggwlnvrdsknhtdfkitydiyatpvlyvldknkv
iiakrigyenlddflvqyekslktk

Timeline for d3hcza1:

• d3hcza1 first appeared in SCOPe 2.03, called d3hcza_
  
• d3hcza1 appears in SCOPe 2.07