Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein automated matches [232361] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232384] (6 PDB entries) |
Domain d3h3ba1: 3h3b A:1-165 [232413] Other proteins in same PDB: d3h3ba2, d3h3ba3, d3h3bb2, d3h3bb3, d3h3bc1, d3h3bc2, d3h3bd1, d3h3bd2 automated match to d1n8zc1 |
PDB Entry: 3h3b (more details), 2.45 Å
SCOPe Domain Sequences for d3h3ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h3ba1 c.10.2.5 (A:1-165) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelql rslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn
Timeline for d3h3ba1: