Lineage for d3h3ba1 (3h3b A:0-165)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1583962Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 1584013Protein automated matches [232361] (1 species)
    not a true protein
  7. 1584014Species Human (Homo sapiens) [TaxId:9606] [232384] (3 PDB entries)
  8. 1584015Domain d3h3ba1: 3h3b A:0-165 [232413]
    Other proteins in same PDB: d3h3ba2, d3h3bb2, d3h3bc1, d3h3bc2, d3h3bd1, d3h3bd2
    automated match to d1n8zc1

Details for d3h3ba1

PDB Entry: 3h3b (more details), 2.45 Å

PDB Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d3h3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3ba1 c.10.2.5 (A:0-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

SCOPe Domain Coordinates for d3h3ba1:

Click to download the PDB-style file with coordinates for d3h3ba1.
(The format of our PDB-style files is described here.)

Timeline for d3h3ba1: