Lineage for d3h4ee2 (3h4e E:148-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706633Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [232387] (4 PDB entries)
  8. 2706641Domain d3h4ee2: 3h4e E:148-219 [232391]
    Other proteins in same PDB: d3h4ea1, d3h4eb1, d3h4ec1, d3h4ed1, d3h4ee1, d3h4ef1, d3h4eg1, d3h4eh1, d3h4ei1, d3h4ej1, d3h4ek1, d3h4el1
    automated match to d1e6jp1

Details for d3h4ee2

PDB Entry: 3h4e (more details), 2.7 Å

PDB Description: x-ray structure of hexameric hiv-1 ca
PDB Compounds: (E:) capsid protein p24

SCOPe Domain Sequences for d3h4ee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h4ee2 a.28.3.0 (E:148-219) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

SCOPe Domain Coordinates for d3h4ee2:

Click to download the PDB-style file with coordinates for d3h4ee2.
(The format of our PDB-style files is described here.)

Timeline for d3h4ee2: