Lineage for d3h3bb1 (3h3b B:0-165)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353403Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1353461Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1353531Family c.10.2.5: L domain [52071] (6 proteins)
  6. Protein automated matches [232361] (1 species)
    not a true protein
  7. 1353583Species Homo sapiens [TaxId:9606] [232384] (2 PDB entries)
  8. 1353585Domain d3h3bb1: 3h3b B:0-165 [232386]
    Other proteins in same PDB: d3h3ba2, d3h3bb2, d3h3bc1, d3h3bc2, d3h3bd1, d3h3bd2
    automated match to d1n8zc1

Details for d3h3bb1

PDB Entry: 3h3b (more details), 2.45 Å

PDB Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain
PDB Compounds: (B:) Receptor tyrosine-protein kinase erbB-2

SCOPe Domain Sequences for d3h3bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3bb1 c.10.2.5 (B:0-165) automated matches {Homo sapiens [TaxId: 9606]}
stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

SCOPe Domain Coordinates for d3h3bb1:

Click to download the PDB-style file with coordinates for d3h3bb1.
(The format of our PDB-style files is described here.)

Timeline for d3h3bb1: