Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (11 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [232366] (2 PDB entries) |
Domain d3h3ua1: 3h3u A:2-144 [232368] Other proteins in same PDB: d3h3ua2, d3h3ub2 automated match to d3r6sf1 complexed with cmp, so4 |
PDB Entry: 3h3u (more details), 2.9 Å
SCOPe Domain Sequences for d3h3ua1:
Sequence, based on SEQRES records: (download)
>d3h3ua1 b.82.3.0 (A:2-144) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} deilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrra pdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeise qllrvlarrlrrtnnnladlift
>d3h3ua1 b.82.3.0 (A:2-144) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} deilaragifqgaiaaltqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdgrenl ltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvla rrlrrtnnnladlift
Timeline for d3h3ua1: