Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) automatically mapped to Pfam PF00632 |
Family d.148.1.0: automated matches [227207] (1 protein) not a true family |
Protein automated matches [226939] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225255] (8 PDB entries) |
Domain d3h1da_: 3h1d A: [232357] automated match to d2onia_ complexed with so4 |
PDB Entry: 3h1d (more details), 1.89 Å
SCOPe Domain Sequences for d3h1da_:
Sequence, based on SEQRES records: (download)
>d3h1da_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssglevlfqgphmdfdvkrkyfrqelerldeglrkedmavhvrrdhvfedsyrelhrksp eemknrlyivfegeegqdaggllrewymiisremfnpmyalfrtspgdrvtytinpssha npnhlsyfkfvgrivakavydnrllecyftrsfykhilgksvrytdmesedyhfyqglvy llendvstlgydltfstevqefgvaevrdlkpnganilvteenkkeyvhlvcqmrmtgai rkqlaaflegfyeiipkrlisifteqelellisglptididdlksnteyhkyqsnsiqiq wfwralrsfdqadrakflqfvtgtskvplqgfaalegmngiqkfqihrddrstdrlpsah tcfnqldlpayesfeklrhmlllaiqe
>d3h1da_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssglevlfqgphmdfdvkrkyfrqelerldeglrkedmavhvrrdhvfedsyrelhrksp eemknrlyivfegeegqdaggllrewymiisremfnpmyalfrtspgdrvtytinpsnhl syfkfvgrivakavydnrllecyftrsfykhilgksvrytdmesedyhfyqglvyllend vstlgydltfstevqefgvaevrdlkpnganilvteenkkeyvhlvcqmrmtgairkqla aflegfyeiipkrlisifteqelellisglptididdlksnteyhkyqsnsiqiqwfwra lrsfdqadrakflqfvtgtskvplqgfaalegmngiqkfqihrddrstdrlpsahtcfnq ldlpayesfeklrhmlllaiqe
Timeline for d3h1da_: