Lineage for d3h1da_ (3h1d A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437266Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 1437267Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 1437283Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 1437284Protein automated matches [226939] (1 species)
    not a true protein
  7. 1437285Species Human (Homo sapiens) [TaxId:9606] [225255] (6 PDB entries)
  8. 1437286Domain d3h1da_: 3h1d A: [232357]
    automated match to d2onia_
    complexed with so4

Details for d3h1da_

PDB Entry: 3h1d (more details), 1.89 Å

PDB Description: structure of the huwe1 hect domain
PDB Compounds: (A:) E3 ubiquitin-protein ligase HUWE1

SCOPe Domain Sequences for d3h1da_:

Sequence, based on SEQRES records: (download)

>d3h1da_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssglevlfqgphmdfdvkrkyfrqelerldeglrkedmavhvrrdhvfedsyrelhrksp
eemknrlyivfegeegqdaggllrewymiisremfnpmyalfrtspgdrvtytinpssha
npnhlsyfkfvgrivakavydnrllecyftrsfykhilgksvrytdmesedyhfyqglvy
llendvstlgydltfstevqefgvaevrdlkpnganilvteenkkeyvhlvcqmrmtgai
rkqlaaflegfyeiipkrlisifteqelellisglptididdlksnteyhkyqsnsiqiq
wfwralrsfdqadrakflqfvtgtskvplqgfaalegmngiqkfqihrddrstdrlpsah
tcfnqldlpayesfeklrhmlllaiqe

Sequence, based on observed residues (ATOM records): (download)

>d3h1da_ d.148.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssglevlfqgphmdfdvkrkyfrqelerldeglrkedmavhvrrdhvfedsyrelhrksp
eemknrlyivfegeegqdaggllrewymiisremfnpmyalfrtspgdrvtytinpsnhl
syfkfvgrivakavydnrllecyftrsfykhilgksvrytdmesedyhfyqglvyllend
vstlgydltfstevqefgvaevrdlkpnganilvteenkkeyvhlvcqmrmtgairkqla
aflegfyeiipkrlisifteqelellisglptididdlksnteyhkyqsnsiqiqwfwra
lrsfdqadrakflqfvtgtskvplqgfaalegmngiqkfqihrddrstdrlpsahtcfnq
ldlpayesfeklrhmlllaiqe

SCOPe Domain Coordinates for d3h1da_:

Click to download the PDB-style file with coordinates for d3h1da_.
(The format of our PDB-style files is described here.)

Timeline for d3h1da_: