Lineage for d3gzxa1 (3gzx A:18-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782646Species Comamonas testosteroni [TaxId:285] [232352] (2 PDB entries)
  8. 2782648Domain d3gzxa1: 3gzx A:18-178 [232353]
    Other proteins in same PDB: d3gzxa2, d3gzxb_
    automated match to d1o7na1
    complexed with bnl, fe2, fes, gol, mes

Details for d3gzxa1

PDB Entry: 3gzx (more details), 1.58 Å

PDB Description: crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. strain b-356
PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d3gzxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzxa1 b.33.1.0 (A:18-178) automated matches {Comamonas testosteroni [TaxId: 285]}
nwtpdairalvdqdngkldariyadqdlyqlelervfgrswlmlghethipkigdyltty
mgedpvimvrqkdqsikvflnqcrhrgmrivrsdggnakaftctyhgwaydiagnlvnvp
fekeafcdkkegdcgfdkadwgplqarvetykglvfanwdp

SCOPe Domain Coordinates for d3gzxa1:

Click to download the PDB-style file with coordinates for d3gzxa1.
(The format of our PDB-style files is described here.)

Timeline for d3gzxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gzxa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3gzxb_