SCOPe 2.07: Domain d3gymb_: 3gym B:

Lineage for d3gymb_ (3gym B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (33 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (92 PDB entries)

8. Domain d3gymb_: 3gym B: [232351]
   Other proteins in same PDB: d3gymi_, d3gymj_
   automated match to d3gylb_

Details for d3gymb_

PDB Entry: 3gym, 2.8 Å

PDB Description: structure of prostasin in complex with aprotinin

PDB Compounds: (B:) Prostasin

SCOPe Domain Sequences for d3gymb_:

Sequence; same for both SEQRES and ATOM records:

>d3gymb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itggssavagqwpwqvsityegvhvcggslvseqwvlsaahcfpsehhkeayevklgahq
ldsysedakvstlkdiiphpsylqegsqgdiallqlsrpitfsryirpislpaaqasfpn
glhctvtgwghvapsvslltpkplqqlevplisretcnslynidakpeephfvqedmvca
gyveggkdacqgdsggplscpveglwyltgivswgdacgarnrpgvytlassyaswiqsk
v

Timeline for d3gymb_:

• d3gymb_ first appeared in SCOPe 2.03
  
• d3gymb_ appears in SCOPe 2.06
  
• d3gymb_ appears in the current release, SCOPe 2.08