Lineage for d3gmqa2 (3gmq A:186-279)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034543Domain d3gmqa2: 3gmq A:186-279 [232305]
    Other proteins in same PDB: d3gmqa1, d3gmqa3, d3gmqb_
    automated match to d3hujc2
    complexed with edo, nag, plm

Details for d3gmqa2

PDB Entry: 3gmq (more details), 1.8 Å

PDB Description: structure of mouse cd1d expressed in sf9 cells, no ligand added
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmqa2:

Sequence, based on SEQRES records: (download)

>d3gmqa2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3gmqa2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatldv
eageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3gmqa2:

Click to download the PDB-style file with coordinates for d3gmqa2.
(The format of our PDB-style files is described here.)

Timeline for d3gmqa2:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gmqb_