SCOPe 2.04: Domain d3gmra2: 3gmr A:186-279

Lineage for d3gmra2 (3gmr A:186-279)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3gmra2: 3gmr A:186-279 [232303]
   Other proteins in same PDB: d3gmra1, d3gmrb_
   automated match to d3hujc2
   complexed with c8p, edo, pg4, plm

Details for d3gmra2

PDB Entry: 3gmr, 1.9 Å

PDB Description: structure of mouse cd1d in complex with c8ph, different space group

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmra2:

Sequence; same for both SEQRES and ATOM records:

>d3gmra2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Timeline for d3gmra2:

• d3gmra2 first appeared in SCOPe 2.03
  
• d3gmra2 appears in SCOPe 2.05
  
• d3gmra2 appears in the current release, SCOPe 2.08