SCOPe 2.05: Domain d3gmma1: 3gmm A:7-185

Lineage for d3gmma1 (3gmm A:7-185)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)

8. Domain d3gmma1: 3gmm A:7-185 [232293]
   Other proteins in same PDB: d3gmma2, d3gmmb_
   automated match to d3hujc1
   complexed with c8p, edo, nag, plm

Details for d3gmma1

PDB Entry: 3gmm, 1.8 Å

PDB Description: structure of mouse cd1d in complex with c8ph

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmma1:

Sequence; same for both SEQRES and ATOM records:

>d3gmma1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3gmma1:

• d3gmma1 first appeared in SCOPe 2.03
  
• d3gmma1 appears in SCOPe 2.04
  
• d3gmma1 appears in SCOPe 2.06
  
• d3gmma1 appears in the current release, SCOPe 2.08