SCOPe 2.07: Domain d3gm0a2: 3gm0 A:142-250

Lineage for d3gm0a2 (3gm0 A:142-250)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3gm0a2: 3gm0 A:142-250 [232290]
   automated match to d1moea1
   complexed with b41

Details for d3gm0a2

PDB Entry: 3gm0, 2.4 Å

PDB Description: Anti-methamphetamine single chain Fv in complex with MDMA

PDB Compounds: (A:) anti-methamphetamine single chain Fv

SCOPe Domain Sequences for d3gm0a2:

Sequence; same for both SEQRES and ATOM records:

>d3gm0a2 b.1.1.0 (A:142-250) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsnlasgvpa
rfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikra

Timeline for d3gm0a2:

• d3gm0a2 first appeared in SCOPe 2.03
  
• d3gm0a2 appears in SCOPe 2.06
  
• d3gm0a2 appears in the current release, SCOPe 2.08