Lineage for d3gm0a1 (3gm0 A:9-125)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1297218Species Mus musculus [TaxId:10090] [227304] (35 PDB entries)
  8. 1297235Domain d3gm0a1: 3gm0 A:9-125 [232289]
    automated match to d1moea2
    complexed with b41

Details for d3gm0a1

PDB Entry: 3gm0 (more details), 2.4 Å

PDB Description: Anti-methamphetamine single chain Fv in complex with MDMA
PDB Compounds: (A:) anti-methamphetamine single chain Fv

SCOPe Domain Sequences for d3gm0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gm0a1 b.1.1.0 (A:9-125) automated matches {Mus musculus [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvs

SCOPe Domain Coordinates for d3gm0a1:

Click to download the PDB-style file with coordinates for d3gm0a1.
(The format of our PDB-style files is described here.)

Timeline for d3gm0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gm0a2