Lineage for d3gl3d_ (3gl3 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879372Species Chlorobium tepidum [TaxId:194439] [232284] (1 PDB entry)
  8. 2879376Domain d3gl3d_: 3gl3 D: [232288]
    Other proteins in same PDB: d3gl3a2, d3gl3b2
    automated match to d4nmub_

Details for d3gl3d_

PDB Entry: 3gl3 (more details), 2.09 Å

PDB Description: crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum
PDB Compounds: (D:) Putative Thiol:disulfide interchange protein DsbE

SCOPe Domain Sequences for d3gl3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gl3d_ c.47.1.0 (D:) automated matches {Chlorobium tepidum [TaxId: 194439]}
kgdkapdfalpgktgvvklsdktgsvvyldfwaswcgpcrqsfpwmnqmqakykakgfqv
vavnldaktgdamkflaqvpaeftvafdpkgqtprlygvkgmptsflidrngkvllqhvg
frpadkealeqqilaal

SCOPe Domain Coordinates for d3gl3d_:

Click to download the PDB-style file with coordinates for d3gl3d_.
(The format of our PDB-style files is described here.)

Timeline for d3gl3d_: