SCOPe 2.06: Domain d3g9wb2: 3g9w B:312-408

Lineage for d3g9wb2 (3g9w B:312-408)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [232271] (5 PDB entries)

8. Domain d3g9wb2: 3g9w B:312-408 [232274]
   Other proteins in same PDB: d3g9wa1, d3g9wa3, d3g9wb1
   automated match to d1mixa2
   complexed with gol, peg

Details for d3g9wb2

PDB Entry: 3g9w, 2.17 Å

PDB Description: Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail

PDB Compounds: (B:) Talin-2

SCOPe Domain Sequences for d3g9wb2:

Sequence; same for both SEQRES and ATOM records:

>d3g9wb2 b.55.1.0 (B:312-408) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gvsfflvkekmkgknklvprllgitkdsvmrvdektkevlqewplttvkrwaaspksftl
dfgeyqesyysvqttegeqisqliagyidiilkkkqs

Timeline for d3g9wb2:

• d3g9wb2 first appeared in SCOPe 2.03
  
• d3g9wb2 appears in SCOPe 2.05
  
• d3g9wb2 appears in SCOPe 2.07
  
• d3g9wb2 appears in the current release, SCOPe 2.08