Lineage for d3g7fh2 (3g7f H:37-258)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790616Protein automated matches [226918] (3 species)
    not a true protein
  7. 1790617Species Blastochloris viridis [TaxId:1079] [232267] (4 PDB entries)
  8. 1790619Domain d3g7fh2: 3g7f H:37-258 [232268]
    Other proteins in same PDB: d3g7fc_, d3g7fh1, d3g7fl_, d3g7fm_
    automated match to d1dxrh1
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1; mutant

Details for d3g7fh2

PDB Entry: 3g7f (more details), 2.5 Å

PDB Description: Crystal structure of Blastochloris viridis heterodimer mutant reaction center
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3g7fh2:

Sequence, based on SEQRES records: (download)

>d3g7fh2 b.41.1.1 (H:37-258) automated matches {Blastochloris viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilsd
qfanvprlqsrdqitlreedkvsayyaggllyatperaeall

Sequence, based on observed residues (ATOM records): (download)

>d3g7fh2 b.41.1.1 (H:37-258) automated matches {Blastochloris viridis [TaxId: 1079]}
rregyplvepedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqpt
gnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgve
agtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilsdqfanvprl
qsrdqitlreedkvsayyaggllyatperaeall

SCOPe Domain Coordinates for d3g7fh2:

Click to download the PDB-style file with coordinates for d3g7fh2.
(The format of our PDB-style files is described here.)

Timeline for d3g7fh2: